Last Updated: May 2026. Not affiliated with The New York Times Company, Hasbro, Zynga, or any game publisher. Word game names including Wordle, Spelling Bee, Connections, and Scrabble are trademarks of their respective owners.

5-Letter Words Starting With K

Use this list after confirming K as the first letter. Compare the remaining positions, rule out letters you already tested, and prioritize highlighted Wordle answers.

All 65 five-letter words in the ENABLE dictionary that start with K. Wordle answer words are highlighted.

Use this page when you know the first letter of your Wordle answer. If your Wordle clue shows a green tile in position 1 with the letter K, every valid answer on this page is a candidate.

K tiles are worth 5 points each.

Top Wordle picks starting with K: KNEEL, KNELT, KNIFE.

Filtering here narrows your options from 2,309 possible Wordle answers to 65 candidates.

How to Use This Page

This list is generated from the ENABLE word list, a public domain dictionary of 172,823 words used by many word-game apps and word finders. It is much larger than the official Wordle answer list, so it includes plenty of words that are valid guesses but have never been, and likely never will be, a Wordle solution.

  1. Check the highlighted box first. The 20 words in the "Common Wordle answers" panel below are drawn from the official Wordle answer list. Everything else in the full list is a valid ENABLE dictionary word, meaning Wordle will accept it as a guess, but it is far less likely to be that day's answer.
  2. Confirm your constraint. This page only helps once you know the word starts with K, meaning you have a green tile in position 1. If K is yellow instead, the word contains K somewhere else, and this page is the wrong filter.
  3. Cross-reference with other tools. For a full green, yellow, and grey filter across all five positions, use the Wordle Helper. If you want to browse every five-letter word regardless of starting letter, see 5-Letter Words.
  4. Use it outside Wordle too. The same list works for the Word Unscrambler if you have scrambled letters that include K, or the Anagram Solver if you are solving a five-letter anagram. Scrabble and Words With Friends players can check scores with the Scrabble Word Finder.
Advertisement

Common Wordle answers (20)

kappakarmakayakkebabkhakikinkykioskkittyknackknavekneadkneedkneelkneltknifeknockknollknownkoalakrill

All 5-letter words starting with K

kababkabarkabobkadiskafirkaguskaiakkaifskailskainskakaskakiskalamkaleskalifkalpakameskamikkanaskaneskanjikaonskapaskaphskapokkappakaputkaratkarmakarnskarookarstkartskashakataskaurikaurykavaskayakkayoskazookbarskebabkebarkebobkeckskedgekeefskeekskeelskeenskeepskeetskeevekefirkeirskelepkelimkellykelpskelpykempskemptkenafkenchkendokenoskepiskerbskerfskernekernskerryketchketolkevelkevilkexeskeyedkhadikhafskhakikhanskhaphkhatskhedakhethkhetskhoumkiangkibbekibbikibeikibeskiblakickskickykiddokiddykiefskierskikeskilimkillskilnskiloskiltskiltykinaskindskineskingskininkinkskinkykinoskioskkirkskirnskissykistskitedkiterkiteskithekithskittykivaskiwisklongkloofklugeklutzknackknapsknarsknaurknavekneadkneedkneelkneesknellkneltknifeknishknitsknobsknockknollknopsknospknotsknoutknownknowsknurlknurskoalakoanskoelskohlskoinekolaskoloskonkskookskookykopekkophskopjekoppakoraikoratkorunkotoskotowkraalkraftkraitkrautkreepkrillkronakronekroonkrubikudoskuduskudzukugelkukrikulakkumyskurtakuruskussokvasskyackkyakskyarskyatskylixkyriekyteskythe

Wordle Strategy for a Green K in Position 1

A confirmed K in position 1 is one of the more informative early clues, because it immediately eliminates the vast majority of the 2,309 possible Wordle answers that do not start with K. Out of those 2,309, only 20 start with K, roughly 1 percent of the full answer pool.

Your next move should target the letter that most often follows K. In this word list, A is the most frequent second letter, appearing in 41 of the 65 words. A guess that pairs K with A in position 2, alongside other high-frequency letters, is a solid way to test multiple positions in a single guess.

Avoid repeating K in a later guess position unless you suspect a double letter. 92 of the words in this list contain a repeated letter, so double letters are not unusual here.

Vowel and Consonant Patterns

Vowel distribution matters when you are deciding which letters to test next. About 39 percent of words starting with K contain the vowel A, and 35 percent contain E. If you have already guessed both of those vowels without a match, shift your next guess toward less common vowels or consonant-heavy words instead.

Consonant clusters right after K are also worth noting. Words like the ones listed above often follow a consonant-vowel-consonant-vowel-consonant shape, though words starting with a consonant cluster (two consonants in a row after K) behave differently and are worth scanning separately if your guesses have ruled out common vowel-second patterns.

Scrabble and Spelling Bee Angle

K tiles are worth 5 points each.

The highest-scoring five-letter word starting with K in this list is kudzu at 19 points using standard Scrabble letter values, before any double or triple letter and word score multipliers. Words with J, Q, X, or Z tiles are always worth checking first when you are trying to maximize a single play.

For NYT Spelling Bee, this list is useful when K is the mandatory center letter, since every valid answer must include it. Scan the full list above for words that use only letters available in that day's puzzle, and remember Spelling Bee requires at least four letters with no more than seven distinct letters used.

Quick Tips

  • Use the highlighted Wordle answer box first if you are actively solving today's puzzle.
  • Combine this filter with an ending-letter filter for an even shorter list.
  • For Scrabble, sort mentally by tile value if you are chasing a high score, not just word length.
  • Bookmark the Wordle Helper for a faster full-constraint search next time.

Frequently Asked Questions

The ENABLE word list contains 65 five-letter words starting with K. Of those, 20 appear in the official Wordle answer list of 2,309 common 5-letter words, which is about 1 percent of every possible Wordle solution. This page shows all 65 words and marks which ones have appeared as Wordle answers. The most common Wordle words starting with K include KNEEL, KNELT, KNIFE.
Filter by starting letter once you have a green tile in position 1, or once your guesses have ruled out enough other letters that K is the only remaining option for the first slot. If your first guess was CRANE and C showed yellow, that means C is in the word but not first, so do not filter for K starters yet. Once position 1 is confirmed green, this list becomes your full candidate pool.
Among the 65 five-letter words starting with K, KUDZU scores the highest at 19 points using standard Scrabble tile values, before any board multipliers. K tiles are worth 5 points each. Use the Scrabble Word Finder to sort every option by score for your exact rack.
Among words starting with K, the letter that appears second most often is A, showing up in 41 of the 65 words. If your Wordle guess confirms K in position 1 but the second letter is still unknown, trying a guess with A in position 2 is a statistically reasonable next test letter.
Yes. About 39 percent of these words contain the vowel A, and roughly 35 percent contain E. Knowing which vowels are most likely lets you pick a smarter second guess. If your first guess already tested common vowels, focus remaining guesses on consonants that have not yet appeared.
Many are. K tiles are worth 5 points each. For Spelling Bee, words starting with K can be useful pangram candidates if K is the required center letter that day. For Scrabble and Words With Friends, check this list for words that use letters remaining on your rack, since starting-letter lists are a fast way to browse valid five-letter plays.