Last Updated: May 2026. Not affiliated with The New York Times Company, Hasbro, Zynga, or any game publisher. Word game names including Wordle, Spelling Bee, Connections, and Scrabble are trademarks of their respective owners.

5-Letter Words Ending With S

Use this list after confirming S in the final position. Compare the first four letters with your clues and prioritize highlighted Wordle answers.

All 1190 five-letter words in the ENABLE dictionary that end with S. Wordle answer words are highlighted.

Use this page when you know the last letter of your Wordle answer. If position 5 shows a green tile with the letter S, every word on this page is a valid candidate.

S is the most common final letter in English by far. It pluralizes most nouns and creates third-person verb forms.

Narrowing from 2,309 possible Wordle answers to 1190 words ending in S makes your next guess much more targeted.

How to Use This Page

This list comes from the ENABLE dictionary, a 172,823-word public domain list used across many word-game tools. It is much broader than the Wordle answer list, so many words here are valid Wordle guesses but have never been an actual solution.

  1. Start with the highlighted panel. The 36 words shown in the "Common Wordle answers" box are pulled from the real Wordle answer list. The rest of the words below are ENABLE dictionary entries that Wordle will accept as guesses even though they are unlikely to be the day's solution.
  2. Confirm your clue. This page assumes position 5 is a confirmed green tile with S. If S showed up yellow instead, it belongs somewhere else in the word, and this ending-letter filter does not apply yet.
  3. Stack filters for speed. Combine this ending-letter constraint with green, yellow, and grey letters from other positions using the Wordle Helper. To browse without any ending filter, see 5-Letter Words.
  4. Reuse the list elsewhere. These same words work for the Word Unscrambler and Anagram Solver when S is one of your scrambled letters, and for the Scrabble Word Finder when you need a word to end your play on a specific board tile.
Advertisement

Common Wordle answers (36)

abyssamassamissbasisblessblissbonusbrasschaoschessclasscrasscresscrossdressdrossethosfetusficusflossfocusglassglossgrassgrossguesshumuslocuslupusminusmucuspressrebustorustrussvirus

All 5-letter words ending with S

abbasabbesabetsablesabrisabutsabyesabyssachesacidsacmesacnesacresacylsadiosaditsadzesaedesaegisaeonsafarsagarsagersaghasagiosagmasagonsaguesaidesairnsairtsakeesalansalbasalecsalefsalfasalgasaliasalifsalmasalmesaloesaltosalumsamahsamassambosamensamiasamidsamiesaminsamirsamissammosamoksamylsangasanilsankhsankusanlasannasanoasantasantesantisapersaphisapodsapresapsesapsisaquasaraksarcusareasargusariasarilsarlesarrasarrisarsesarsisarumsarvosarylsascusashesaskosaspisassesatapsatlasatmasatomsauntsaurasauresaurisautosavensaversavgasavowsawolsaxelsaxilsaxlesaxonsayahsayinsazansazonsbaalsbabasbabesbabusbacksbaffsbahtsbailsbaitsbakesbalasbaldsbalesbalksballsbalmsbandsbanesbangsbanksbannsbarbsbardsbaresbarfsbarksbarmsbarnsbasesbasisbasksbastsbatesbathsbattsbaudsbawdsbawlsbeadsbeaksbeamsbeansbearsbeatsbeausbecksbeefsbeepsbeersbeetsbellsbeltsbemasbendsbenesbentsbergsbermsbestsbetasbethsbhutsbibbsbicesbidesbiersbiffsbikesbilesbilksbillsbimasbindsbinesbintsbirdsbirksbirlsbirrsbisesbisksbitesbittsbizesblabsblahsblamsblatsblawsblebsblessbletsblipsblissblobsblocsblotsblowsblubsbluesblursboarsboatsbocksbodesboffsbogusboilsbolasboldsbolesbollsbolosboltsbolusbombsbondsbonesbongsbonksbonusboobsbooksboomsboonsboorsbootsborasboresbortsbosksbotasbottsboutsbowlsboxesboyosbozosbradsbraesbragsbransbrassbratsbrawsbraysbreesbrensbrewsbriesbrigsbrimsbrinsbriosbritsbroosbrowsbucksbuffsbuhlsbuhrsbulbsbulksbullsbumfsbumpsbundsbungsbunksbunnsbuntsbuoysburasburbsburdsburgsburlsburnsburpsburrsbusesbusksbustsbuttsbyresbyrlsbytescacascadescadiscafescaffscagescaidscainscakescalfscalkscallscalmscamascamescampscanescantscapescaphscaposcarbscardscarescarkscarlscarnscarpscarrscartscasascasescaskscastscasuscatescaulscavescedescedisceilscellsceltscentscepescerescerosceteschadschamschaoschapscharschatschawschayschefschesschewschiaschicschinschipschitschopschowschubschugschumscinescionscirescistscitescladsclagsclamsclansclapsclassclawsclaysclefsclewsclipsclodsclogsclonsclopsclotscloysclubscluescoalscoatscobbscocascockscocoscodascodescoedscoffscohoscoifscoilscoinscoirscokescolascoldscolescoltscomascombscomescompsconesconksconnsconuscoofscookscoolscoonscoopscootscopescordscorescorkscormscornscorpscosescostscotescoupscovescowlscoxescozescrabscragscramscrapscrasscrawscresscrewscribscriescrocscropscrosscrowscrudscubescuffscuifscukescullsculmscultscuntscurbscurdscurescurfscurlscurnscurrscuskscuspscutescutiscyanscycascymascymescystsczarsdacesdadasdadosdaffsdagosdahlsdalesdamesdamnsdampsdangsdarbsdaresdarksdarnsdartsdatesdatosdaubsdautsdawksdawnsdawtsdazesdeadsdealsdeansdearsdebtsdecksdecosdeedsdeemsdeepsdeersdeetsdefisdegasdeilsdekesdelesdelfsdelisdellsdemesdemosdenesdentsdermsdesksdevasdexesdhaksdhalsdhowsdialsdicesdicksdidosdietsdikesdillsdimesdinesdingsdinksdintsdiolsdirksdirlsdirtsdiscsdisksditasditesdivasdivesdjinsdoatsdocksdodosdoersdoffsdogesdoitsdojosdolesdollsdoltsdomesdonasdongsdoomsdoorsdopasdopesdorksdormsdorpsdorrsdosesdotesdoumsdovesdownsdozesdrabsdragsdramsdratsdrawsdraysdreesdregsdreksdressdribsdriesdripsdropsdrossdrubsdrugsdrumsduadsdualsducesducksductsdudesduelsduetsduffsduitsdukesdullsdumasdumbsdumpsdunesdungsdunksduntsdupesdurasduresdurnsdurosdurrsdusksdustsdyadsdyersdykesdynesearlsearnseaseseastseavesebonsechesechosecrusedgeseditsegadsegerseidoselanselvesemeusemirsemitsemydsenolsenowsepeesephasepicsernesersesessesethosetnasetuiseurosevensevilsewersexamsexecsexitsexonsexposeyerseyraseyresfacesfactsfadesfadosfailsfairsfakesfallsfamesfanesfangsfanosfardsfaresfarlsfarmsfarosfartsfastsfatesfaunsfavasfavesfavusfawnsfaxesfazesfearsfeatsfecesfecksfeedsfeelsfellsfeltsfemesfendsfeodsferesfernsfetasfetesfetusfeudsfezesfiarsfiatsficesficusfidosfiefsfifesfilesfillsfilmsfilosfindsfinesfinisfinksfinosfiresfirmsfirnsfiscsfistsfivesfixesflabsflagsflamsflansflapsflatsflawsflaysfleasfleesflewsfleysflicsfliesflipsflitsflocsfloesflogsflopsflossflowsflubsfluesfoalsfoamsfocusfohnsfoilsfoinsfoldsfolksfondsfontsfoodsfoolsfootsforbsfordsforesforksformsfortsfoulsfoursfowlsfoxesfragsfrapsfrassfratsfraysfreesfretsfriesfrigsfritsfroesfrogsfronsfrowsfrugsfucksfucusfuelsfugusfujisfullsfumesfundsfunksfurlsfusesfuzesfycesfykesgadisgaffsgagesgainsgaitsgalasgalesgallsgamasgambsgamesgampsgangsgaolsgapesgarbsgasesgaspsgastsgatesgaudsgaumsgaursgaussgawksgawpsgazesgearsgecksgeeksgeldsgeltsgenesgentsgenusgermsgestsgetasgeumsghatsgheesgibesgiftsgigasgildsgillsgiltsgimpsginksgirdsgirlsgirnsgirosgirtsgistsgivesgladsglansglassgledsgleesglensgleysgliasglimsglobsglomsglopsglossglowsgluesglugsglutsgnarsgnatsgnawsgoadsgoalsgoatsgobosgoersgogosgoldsgolfsgongsgoodsgoofsgooksgoonsgoopsgoresgorpsgoutsgowdsgowksgownsgoxesgrabsgradsgramsgransgrassgraysgreesgreysgridsgrigsgrinsgripsgritsgrogsgrossgrotsgrowsgrubsgruesguansguarsgucksgudesguessguffsguidsgulesgulfsgullsgulpsgunksgurusgustsgybesgyresgyrosgyrusgyveshaafshaarshabushackshadeshaemshaetshafishaftshahashaikshailshairshajeshajishakeshaleshallshalmshaloshaltshameshandshangshankshantshardsharesharksharlsharmsharpshartshaspshateshaulshaveshawkshazesheadshealsheapshearsheatshebeshecksheedsheelsheftsheilsheirshellshelmsheloshelpshemeshempshentsherbsherdsheresherlshermshernsheroshestshethshexeshickshideshighshikeshillshiltshilushindshintshireshistshiveshoarshoboshockshocushoershoggshokesholdsholesholksholmsholtshomeshomoshoneshongshonkshoodshoofshookshoopshootshopeshorashornshoseshostshourshoweshowfshowkshowlshoyashuckshuffshulashulkshullshumpshumushunkshuntshurdshurlshurtshuskshylashymnshypeshyposiambsiconsictusideasidlesidolsidylsiglusikatsikonsileusimamsimidsimpisincusinfosintisiotasiridsironsisbasislesitemsiviesixiasizarsjacksjadesjaggsjailsjakesjambsjanesjapesjarlsjatosjauksjaupsjavasjeansjeepsjeersjefesjehusjellsjerksjestsjetesjibbsjibesjiffsjillsjiltsjinksjinnsjismsjivesjocksjoeysjohnsjoinsjokesjolesjoltsjonesjotasjouksjowlsjubasjubesjudasjudosjujusjukesjumpsjunksjupesjustsjuteskadiskaguskaifskailskainskakaskakiskaleskameskanaskaneskaonskapaskaphskarnskartskataskavaskayoskbarskeckskeefskeekskeelskeenskeepskeetskeirskelpskempskenoskepiskerbskerfskernskexeskhafskhanskhatskhetskibeskickskiefskierskikeskillskilnskiloskiltskinaskindskineskingskinkskinoskirkskirnskistskiteskithskivaskiwisknapsknarskneesknitsknobsknopsknotsknowsknurskoanskoelskohlskolaskoloskonkskookskophskotoskudoskuduskumyskuruskvasskyakskyarskyatskyteslaceslacksladeslaicslairslakeslakhslallslamaslambslameslampslandslaneslapislardslareslarislarkslaseslastslathslaudslavaslaveslawnslazesleadsleafsleaksleansleapslearsleeksleersleetsleftslegeslehrslendsleneslenislenosleudslewislexeslexisliarslickslidoslienslierslieusliftslikesliltslimaslimbslimeslimnslimoslimpslineslingslinkslinnslinoslintslionsliraslispslistslitaslivesloadsloafsloamsloanslobesloboslochslockslocoslocuslodesloessloftslogeslogosloinslollslongsloofslooksloomsloonsloopslootslopeslordsloreslorisloseslotaslotoslotuslouisloupsloursloutsloveslowesloxesluauslubesluceslucksludesluffslugeslullsluluslumpslunasluneslungslunksluntslupuslureslurkslustslususlutesluxeslweislyreslyseslysismaarsmabesmacesmachsmacksmagesmagusmaidsmailsmaimsmainsmairsmakesmakosmalesmallsmalmsmaltsmamasmanasmanesmanosmanusmarcsmaresmarksmarlsmartsmasksmastsmatesmathsmattsmaudsmaulsmautsmavismaxesmaxismayasmayosmazesmeadsmealsmeansmeatsmeedsmeetsmeldsmellsmeltsmemosmendsmenusmeousmeowsmeresmerksmerlsmesasmetesmethsmetismewlsmezesmicasmicksmidismiensmiffsmiggsmikesmilesmilksmillsmilosmiltsmimesminasmindsminesminisminksmintsminusmiresmirksmisesmisosmistsmitesmitismittsmixesmoansmoatsmocksmodesmodusmoilsmojosmokesmolasmoldsmolesmollsmoltsmomesmomusmonasmonksmonosmoodsmoolsmoonsmoorsmootsmopesmorasmoresmornsmortsmosksmostsmotesmothsmottsmouesmovesmoxasmozosmucksmucusmuffsmuggsmulesmullsmummsmumpsmumusmunismuonsmurasmuresmurksmurrsmusesmusksmustsmutesmuttsmynasmythsnaansnabesnabisnadasnaifsnailsnamesnanasnapesnarcsnardsnaresnarisnarksnatesnavesnazisneapsnearsneatsnecksneedsneemsneepsnegusneifsnemasneonsnerdsnertsnestsnettsneuksneumsnevesnevusnewtsnexusnicksnidesnidusnighsnillsninesnipasnisusnitesnixesnocksnodesnodusnoelsnoggsnoilsnoirsnolosnomasnomesnomosnonasnonesnooksnoonsnorisnormsnosesnotesnounsnovasnowtsnudesnukesnullsnumbsnurdsnurlsoasesoasisoastsoathsoavesobeysobiasobitsoboesobolsodorsodylsofaysogamsogeesoglesogresohiasoinksokaysokehsokrasoleosoliosollasomensomersomitsoozesopahsopalsopensoralsorcasordosorlesornisorrisorzosottosouphsoustsouzosovalsovensoversoxidsoximsoyerspacaspacespackspactspadispagespaikspailspainspairspalespallspalmspalpspanespangspantspapasparaspardsparesparisparksparrspartspasespastspatespathspavespavispawlspawnspaxespeagspeakspealspeanspearspeatspechspeckspedespeekspeelspeenspeepspeerspeinspekespelespelfspeltspendspenespenispeonspeposperisperkspermspesospestsphonsphotsphutspianspicaspickspierspikaspikespikispilespilispillspiluspimaspimpspinaspinespingspinkspintspionspiouspipespirnspisospitaspithspixesplansplatsplayspleasplebsplewspliesplodsplopsplotsplowsploysplugsplumspockspoemspoetspokespolespolispollspolospolyspomespompspondsponespongspoodspoofspoohspoolspoonspoopspopesporesporkspornsportsposespostspoufspourspoutspoxespramspraospratsprausprayspreesprepspresspreyspriesprigsprimsprissproasprodsprofsprogspromspropsprossprowspsoaspubespubispucespuckspuffspujaspukespulespulispullspulpspumaspumpspunaspungspunkspuntspupaspurispurlspurrspusesputtspyinspyrespyxespyxisqaidsqophsquadsquagsquaisquassquaysqueysquidsquinsquipsquitsquodsracesracksraffsraftsragasragesragisraiasraidsrailsrainsrajasrajesrakesrakisralesrampsramusrandsranisranksrantsrapesraresrasesraspsratesratosravesraxesrayasrazesreadsrealsreamsreapsrearsrebusrecksreddsredesredosreedsreefsreeksreelsregesreifsreinsrendsrentsreposreppsrestsrexesrheasrialsribesricesricksridesrielsriffsriftsrilesrillsrimesrindsringsrinksriotsripesrisesrisksrisusritesrivesroadsroamsroansroarsrobesrocksroilsrolesrolfsrollsrompsroodsroofsrooksroomsrootsropesrosesrotasrotesrotisrotlsrotosrouesroupsroutsrovesrubesrubusrucksruddsruersruffsruinsrulesrumpsrunesrungsruntsrusesrusksrustsruthsrykesryndsryotssabessackssadessadissafessagassagessagossaidssailssainssakessakissalessalpssaltssampssandssanessardssarissarkssarossatessatissaulssavessaxesscabsscadsscagsscamsscansscarsscatsscopsscotsscowsscudsscumsscupsscutssealsseamssearsseatssectsseedsseeksseelsseemsseepsseerssegosseifsselfssellssemessemissendsseptsseresserfssettssexessextsshadsshagsshahsshamsshawsshayssheasshedsshewsshiesshimsshinsshipsshitsshivsshoesshogsshoosshopsshotsshowsshrisshulsshunsshutssialssibbssicessickssidessiftssighssignssikessildssilkssillssilossiltssimassimpssinessingssinhssinkssinussipessiressisessitessitussixessizesskagsskatsskeesskegsskepsskewsskidsskiesskimsskinsskipsskitsskuasslabsslagsslamsslapsslatsslawsslayssledsslewsslimsslipsslitsslobssloesslogsslopsslotsslowsslubssluesslugsslumsslursslutssmewssmogssmutssnagssnapssnawssnedssnibssnipssnitssnobssnogssnotssnowssnubssnugssnyessoakssoapssoarssockssodassofassoftssoilssojassokessolessolossolussomassonessongssookssootssophssorassorbssordssoressornssortssorussothssoukssoulssoupssourssoyasspaesspanssparsspatsspaysspecsspewsspicsspiesspiksspinsspitsspivsspotsspudsspuesspursstabsstagsstarsstatsstaysstemsstepsstetsstewsstiesstirsstoasstobsstopsstossstowsstubsstudsstumsstunsstyessubassuckssuddssuerssuetssughssuitssulkssulussumossumpssunnssupessurassurdssurfsswabsswagsswansswapsswatsswaysswigsswimsswissswobsswopsswotssycessykessylissyncssyphstabestabustacestachstackstacostactstaelstahrstailstainstajestakestalastalcstalestalkstalustamestamistampstangstankstapastapestapistarestarnstarostarpstartstaskstatestautstaxestaxistaxusteakstealsteamstearsteatsteelsteemsteensteffstelestellstelostempstendstentstepastermsternsteststethstexastextsthawsthensthewsthinsthousthudsthugstickstidestierstiffstikestikistilestillstiltstimestinestingstintstipistirestirlstirostitistoadstoffstoftstofustogastoilstoitstokestolastolestollstolustombstomestonestongstonustoolstoonstootstopestophstopistopostorastorcstorestorostortstorustotestourstoutstownstoyostramstranstrapstrasstraystreestrekstresstretstrewstreystriestrigstrimstriostripstroistrotstrowstroystruestrugstrusstsarstubastubestuckstufastuffstuftstulestumpstunastunestungsturdsturfsturksturnsturpstuskstutustuxestwaestwatstwigstwinstwitstyeestyerstykestynestypestypostyppstyrestyrostzarsulansulnasulvasumbosunaisunausuncosuncusunitsupdosureasurgesusersuveasvagusvailsvairsvalesvampsvanesvangsvarasvarusvasesvastsvatusvealsveepsveersveilsveinsveldsvendsventsverbsvertsvestsvexesvialsvibesvicesviersviewsvigasvillsvinasvinesvinosviolsviresvirlsvirusvisasvisesvivasvocesvoidsvolesvoltsvotesvrowsvuggsvughswackswadeswadiswaffswaftswageswaifswailswainswairswaitswakeswaleswalkswallswameswamuswandswaneswantswardswareswarkswarmswarnswarpswartswaspswastswattswaukswaulswaveswawlswaxeswealsweanswearsweedsweeksweensweepsweetsweftsweirswekasweldswellsweltswendswestswhamswhapswhatswhenswhetswhewswheyswhidswhigswhimswhinswhipswhirswhitswhopswickswideswifeswildswileswillswiltswimpswindswineswingswinkswinoswipeswireswiseswispswistswiteswiveswizeswoadswoldswolfswombswonkswontswoodswoofswoolswoopswordsworkswormswortswrapswrenswrieswritswyleswyndswynnswytesxerusxystsyacksyaffsyagisyangsyanksyardsyarnsyaudsyaupsyawlsyawnsyawpsyeansyearsyechsyeggsyelksyellsyelpsyerksyesesyetisyettsyeuksyikesyillsyipesyirdsyirrsylemsyocksyodhsyogasyoghsyogisyokesyolksyonisyoresyoursyowesyowlsyuansyucasyucksyugasyulesyurtszarfszaxeszealszebuszeinszerkszeroszestszetaszillszincszingszitiszoeaszoneszonkszookszoomszoonszoriszymes

Wordle Strategy for a Green S in Position 5

A confirmed S in the last position is one of the strongest single clues in Wordle, since it removes every word in the 2,309-word answer list that ends any other way. Only 36 answer words end in S, about 2 percent of the full pool.

To narrow further, look at position 4. Among words ending in S, the letter E shows up right before it most often, in 536 of the 1190 words. Testing that letter in position 4 alongside untested consonants elsewhere in your guess is an efficient way to cover more ground.

Keep in mind that Wordle answers ending in S are intentionally limited, since the puzzle avoids simple plural forms as solutions more often than you might expect, so do not over-rely on S as a default guess.

Vowel and Consonant Patterns

About 38 percent of words ending in S contain the vowel A, and 37 percent contain E. If your earlier guesses already tested those vowels with no match, your remaining guesses should lean toward less common vowels or consonant clusters instead.

Many five-letter words ending in S follow a consonant-vowel pattern right before the final letter, though some end in a double consonant or consonant blend. Scan the list above for the shape that matches your other known letters.

Scrabble and Spelling Bee Angle

The highest-scoring five-letter word ending in S on this page is zaxes at 21 points under standard Scrabble tile values, before multipliers. Words that end in a high-value letter like J, Q, X, or Z are worth checking first for board-ending plays.

For NYT Spelling Bee, an ending-letter filter is less commonly needed since Spelling Bee does not care about word position, but this list is still a fast way to browse valid five-letter words if S is one of the day's allowed letters and you need inspiration for longer entries.

Quick Tips

  • Check the highlighted Wordle answer box first if you are solving today's puzzle.
  • Combine this filter with a starting-letter filter for a much shorter shortlist.
  • For Scrabble, prioritize by tile value, not just by whether a word is common.
  • Use the Wordle Helper for full multi-position filtering in one step.

Frequently Asked Questions

The ENABLE word list contains 1190 five-letter words ending with the letter S. S is the most common final letter in English by far. It pluralizes most nouns and creates third-person verb forms. Of these, 36 appear in the Wordle answer list of 2,309 words, about 2 percent of every possible solution. Use the Wordle Helper to combine the ending-letter constraint with any other clues from your guesses.
If position 5 shows green, you have eliminated every word that does not end with that letter, dropping the field from 2,309 to just 36 known answer words, or 1190 candidates if you count every valid ENABLE word. Combined with other known letters, this often narrows the field to 10 or fewer candidates. Scan this page or use the Wordle Helper with position 5 marked green to see exactly what remains.
The most common Wordle answer words ending with S are shown in the highlighted panel on this page. Words there have appeared as past Wordle solutions, which does not guarantee a repeat but does mean they are common enough vocabulary to be selected. S is the most common final letter in English by far. It pluralizes most nouns and creates third-person verb forms.
Among words ending in S, the letter that appears most often in position 4 is E, found in 536 of the 1190 words. If you already have a green S in position 5 and are unsure of position 4, testing E there is a reasonable next guess.
Yes. About 38 percent of these words contain the vowel A, and around 37 percent contain E. If your first two guesses already tested those vowels without a match in the word, favor consonant-heavy guesses for your remaining attempts.
Often, yes, especially for finishing a rack or hooking onto a tile already on the board. The highest-scoring word ending in S in this list is ZAXES at 21 points under standard Scrabble tile values. Use the Scrabble Word Finder to check scores against your exact rack and any board multipliers in play.